Recombinant Human Methionine Sulfoxide Reductase B protein (ab99522)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSFCSFFGGEVFQNHFEPGVYVCAKCGYEL FSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGH EFLNDGPKPGQSRFCIFSSSLKFVPKGKETSASQGH
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 116
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99522 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM EDTA, 1mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • Annexin A2 like
    • EC 1 8 4
    • HSPC 270
    • HSPC270
    • Methionine R sulfoxide reductase
    • Methionine R sulfoxide reductase B1
    • Methionine sulfoxide reductase
    • Methionine-R-sulfoxide reductase B1
    • MGC3344
    • MSRB 1
    • MsrB1
    • MSRB1_HUMAN
    • OTTHUMP00000159418
    • Sel X
    • Selenoprotein R
    • Selenoprotein X
    • Selenoprotein X 1
    • Selenoprotein X1
    • SELR
    • SelX
    • SEPX 1
    • sepx1
    see all
  • Sequence similarities
    Belongs to the MsrB Met sulfoxide reductase family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99522.

References

ab99522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up