Recombinant Human Methionine Sulfoxide Reductase B protein (ab99522)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NZV6
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSFCSFFGGEVFQNHFEPGVYVCAKCGYEL FSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGH EFLNDGPKPGQSRFCIFSSSLKFVPKGKETSASQGH
    • Molecular weight15 kDa including tags
    • Amino acids1 to 116
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99522 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM EDTA, 1mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • Annexin A2 like
    • EC 1 8 4
    • HSPC 270
    • HSPC270
    • Methionine R sulfoxide reductase
    • Methionine R sulfoxide reductase B1
    • Methionine sulfoxide reductase
    • Methionine-R-sulfoxide reductase B1
    • MGC3344
    • MSRB 1
    • MsrB1
    • MSRB1_HUMAN
    • OTTHUMP00000159418
    • Sel X
    • Selenoprotein R
    • Selenoprotein X
    • Selenoprotein X 1
    • Selenoprotein X1
    • SELR
    • SelX
    • SEPX 1
    • sepx1
    see all
  • Sequence similaritiesBelongs to the MsrB Met sulfoxide reductase family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Methionine Sulfoxide Reductase B protein images

  • 15% SDS-PAGE analysis of 3µg ab99522.

References for Recombinant Human Methionine Sulfoxide Reductase B protein (ab99522)

ab99522 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"