Recombinant Human Methyltransferase like 5 protein (ab162213)

Overview

  • Product name
    Recombinant Human Methyltransferase like 5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDI ENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIFNRNAEEFELT NIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMAR TAVYSLHKSSTREHVQKKAAEWKIKIDIIAELRYDLPASYKFHKKKSVDI EVDLIRFSF
    • Amino acids
      1 to 209
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810410A08Rik
    • DC3
    • FLJ10459
    • HSPC133
    • mCG_12967
    • Methyltransferase like protein 5
    • Methyltransferase-like protein 5
    • METL5_HUMAN
    • METTL 5
    • METTL5
    • MGC187943
    • OTTHUMP00000205107
    • OTTHUMP00000205108
    • OTTHUMP00000205109
    • OTTMUSP00000040951
    • RGD1566062
    see all
  • Function
    Probable methyltransferase.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. PrmA family.
  • Information by UniProt

Images

  • ab162213 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up