Recombinant Human METTL1 protein (ab103495)

Overview

  • Product name
    Recombinant Human METTL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPM ADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEF ADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGG FQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTL LAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPV VGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 276
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103495 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C12orf1
    • D1075 like gene product
    • FLJ95748
    • Methyltransferase like 1
    • Methyltransferase like protein 1
    • Methyltransferase-like protein 1
    • Mettl1
    • TRM8
    • TRMB_HUMAN
    • TRMT8
    • tRNA (guanine N(7) ) methyltransferase
    • tRNA (guanine(46)-N(7))-methyltransferase
    • tRNA (guanine-N(7)-)-methyltransferase
    • tRNA(m7G46) methyltransferase
    • tRNA(m7G46)-methyltransferase
    • YDL201w
    see all
  • Function
    Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    tRNA modification; N(7)-methylguanine-tRNA biosynthesis.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. TrmB family.
  • Post-translational
    modifications
    Phosphorylation at Ser-27 inactivates its catalytic activity but does not affect the interaction with WDR4.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human METTL1 protein images

  • 15% SDS-PAGE analysis of 3µg ab103495.

References for Recombinant Human METTL1 protein (ab103495)

ab103495 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up