Recombinant Human METTL1 protein (ab103495)

Overview

  • Product nameRecombinant Human METTL1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UBP6
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPM ADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEF ADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGG FQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTL LAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPV VGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
    • Molecular weight34 kDa including tags
    • Amino acids1 to 276
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103495 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C12orf1
    • D1075 like gene product
    • FLJ95748
    • Methyltransferase like 1
    • Methyltransferase like protein 1
    • Methyltransferase-like protein 1
    • Mettl1
    • TRM8
    • TRMB_HUMAN
    • TRMT8
    • tRNA (guanine N(7) ) methyltransferase
    • tRNA (guanine(46)-N(7))-methyltransferase
    • tRNA (guanine-N(7)-)-methyltransferase
    • tRNA(m7G46) methyltransferase
    • tRNA(m7G46)-methyltransferase
    • YDL201w
    see all
  • FunctionCatalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
  • Tissue specificityUbiquitous.
  • PathwaytRNA modification; N(7)-methylguanine-tRNA biosynthesis.
  • Sequence similaritiesBelongs to the methyltransferase superfamily. TrmB family.
  • Post-translational
    modifications
    Phosphorylation at Ser-27 inactivates its catalytic activity but does not affect the interaction with WDR4.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human METTL1 protein images

  • 15% SDS-PAGE analysis of 3µg ab103495.

References for Recombinant Human METTL1 protein (ab103495)

ab103495 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"