Recombinant Human METTL1 protein (ab103495)

Overview

  • Product name
    Recombinant Human METTL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPM ADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEF ADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGG FQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTL LAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPV VGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 276
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103495 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C12orf1
    • D1075 like gene product
    • FLJ95748
    • Methyltransferase like 1
    • Methyltransferase like protein 1
    • Methyltransferase-like protein 1
    • Mettl1
    • TRM8
    • TRMB_HUMAN
    • TRMT8
    • tRNA (guanine N(7) ) methyltransferase
    • tRNA (guanine(46)-N(7))-methyltransferase
    • tRNA (guanine-N(7)-)-methyltransferase
    • tRNA(m7G46) methyltransferase
    • tRNA(m7G46)-methyltransferase
    • YDL201w
    see all
  • Function
    Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    tRNA modification; N(7)-methylguanine-tRNA biosynthesis.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. TrmB family.
  • Post-translational
    modifications
    Phosphorylation at Ser-27 inactivates its catalytic activity but does not affect the interaction with WDR4.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103495.

References

ab103495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up