Recombinant Human METTL3 protein (ab163377)

Overview

  • Product name
    Recombinant Human METTL3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS PVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSI CLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADH SKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNS SASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELL NTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPS QELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDI HMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYE RVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDC DVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQ LDGIHLLDPDVVARFKQRYPDGIISKPKNL
    • Amino acids
      1 to 580
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab163377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase
    • IME4
    • M6A
    • Methyltransferase like protein 3
    • Methyltransferase-like protein 3
    • METTL3
    • mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase
    • mRNA m(6)A methyltransferase
    • MT-A70
    • MTA70
    • MTA70_HUMAN
    • N6 adenosine methyltransferase 70 kDa subunit
    • N6-adenosine-methyltransferase 70 kDa subunit
    see all
  • Function
    N6-methyltransferase that methylates adenosine residues of some mRNAs. N6-methyladenosine (m6A), which is present at internal sites of some mRNAs, may play a role in the efficiency of mRNA splicing, transport or translation.
  • Tissue specificity
    Widely expressed at low level. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the MT-A70-like family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus speckle. Colocalizes with speckles in interphase nuclei. Suggesting that it may be associated with nuclear pre-mRNA splicing components.
  • Information by UniProt

Images

  • ab163377 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up