Overview

  • Product name
    Recombinant Human MEX3C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMAAMLSHAYGPGGCGAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVA EIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILS AAEHFSMIRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPK GATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRT GNYIELNEENDFHYNGTDVSFEGGTLGSAWLSSNPVPPSRARMISNYRND SSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVD SPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLS PTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGST SSSPPESRRKHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCP VCQTAVTQAIQIHS
    • Amino acids
      1 to 464
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BM 013
    • BM013
    • FLJ38871
    • Mex 3 homolog C C. elegans
    • Mex 3, C. elegans, homolog of C
    • MEX 3C
    • MEX3C
    • MEX3C_HUMAN
    • Ring finger and KH domain containing 2
    • RING finger and KH domain containing protein 2
    • RING finger and KH domain-containing protein 2
    • RING finger protein 194
    • RKHD2
    • RNA-binding E3 ubiquitin-protein ligase MEX3C
    • RNA-binding protein MEX3C
    • RNF194
    see all
  • Function
    RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms.
  • Tissue specificity
    Highest levels found in fetal brain and testis. Also expressed in thymus, salivary gland and uterus. Week expression in the intestine.
  • Involvement in disease
    Note=Genetic variations in MEX3C may be associated with susceptibility to essential hypertension.
  • Sequence similarities
    Contains 2 KH domains.
    Contains 1 RING-type zinc finger.
  • Domain
    Binds RNA through its KH domains.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway.
  • Information by UniProt

Images

  • ab162509 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up