Overview

  • Product name
    Recombinant Human MFI2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ EADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVT IDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDHFGG SCVPGAGETSYSESLCRLCRGDSPGEGVCDKSPLERYYDYSGAFRCLAEG AGDVAFVKHSTVLENTDESPSRRQTWTRSEEEEGECPAHEEARRTMRSSA GQAWKWAPVHRPQDESDKGEFGKRAKSRDMLG
    • Amino acids
      21 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen p97
    • CD228
    • CD228 antigen
    • MAP97
    • Melanoma associated antigen p97
    • Melanoma-associated antigen p97
    • Melanotransferrin
    • Mfi2
    • MTF1
    • TRFM_HUMAN
    see all
  • Function
    Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc.
  • Tissue specificity
    Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts.
  • Sequence similarities
    Belongs to the transferrin family.
    Contains 2 transferrin-like domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158883 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up