Recombinant Human MFSD2A protein (ab153557)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYA LGGAPYQVTGCALGFFLQIYLLDVAQVGPFSASIILFVGRAWDAITDPLV GLCISKSPWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLF YCLFETMVTCFHVPYSALTMFISTEQTERDSATAYRMTVEVLGTVLGTAI QGQIVGQADTPCFQDLNSSTVASQSANHTHGTTSHRETQKAYLLAAGVIV CIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRLVMSHGPYIKLITG FLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIWQWF LTRFGKKTAVYVGISSAVPFLILVALMESNLIITYAVAVAAGISVAAAFL LPWSMLPDVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSL DFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRR QNKKALQALRDEASSSGCSETDSTELASIL
    • Amino acids
      1 to 530
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700018O18Rik
    • FLJ14490
    • FLJ35904
    • Major facilitator superfamily domain containing 2
    • Major facilitator superfamily domain containing 2A
    • Major facilitator superfamily domain-containing protein 2A
    • MFS2A_HUMAN
    • MFSD2
    • MFSD2A
    • RGD1310174
    • RP23-121J14.3
    see all
  • Function
    Play a role in thermogenesis via beta-adrenergic signaling pathway.
  • Sequence similarities
    Belongs to the major facilitator superfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab153557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up