Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP26572
    • SpeciesHuman
    • SequenceYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAF AKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSWN
    • Molecular weight36 kDa including tags
    • Amino acids348 to 445

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
    • Alpha-1
    • Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
    • GGNT1
    • GLCNAC TI
    • GlcNAc-T I
    • GLCT1
    • GLYT1
    • GNT 1
    • GNT-I
    • Mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
    • MGAT
    • MGAT1
    • MGAT1_HUMAN
    • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
    see all
  • FunctionInitiates complex N-linked carbohydrate formation. Essential for the conversion of high-mannose to hybrid and complex N-glycans.
  • Tissue specificityAppears to be present in all tissues.
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the glycosyltransferase 13 family.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human MGAT1 protein images

  • 12.5% SDS-PAGE showing ab116960 at approximately 36.41kDa stained with Coomassie Blue.

References for Recombinant Human MGAT1 protein (ab116960)

ab116960 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"