Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAF AKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSWN
    • Molecular weight
      36 kDa including tags
    • Amino acids
      348 to 445

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
    • Alpha-1
    • Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
    • GGNT1
    • GLCNAC TI
    • GlcNAc-T I
    • GLCT1
    • GLYT1
    • GNT 1
    • GNT-I
    • Mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
    • MGAT
    • MGAT1
    • MGAT1_HUMAN
    • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
    see all
  • Function
    Initiates complex N-linked carbohydrate formation. Essential for the conversion of high-mannose to hybrid and complex N-glycans.
  • Tissue specificity
    Appears to be present in all tissues.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 13 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116960 at approximately 36.41kDa stained with Coomassie Blue.

References

ab116960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up