Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDIL VPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
    • Molecular weight
      36 kDa including tags
    • Amino acids
      642 to 739

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
    • 6-N-acetylglucosaminyltransferase
    • Alpha 1,3(6) mannosylglycoprotein
    • Alpha 1,6 mannosylglycoprotein 6 beta N acetylglucosaminyltransferase
    • Alpha mannoside beta 1,6 N acetylglucosaminyltransferase
    • Alpha-1
    • Alpha-mannoside beta-1
    • Beta 1,6 N acetyl glucosaminyltransferase
    • GGNT5
    • GlcNAc T V
    • GlcNAc-T V
    • GNT V
    • GNT VA
    • GNT-V
    • GNTV
    • GNTVA
    • Mannoside acetylglucosaminyltransferase 5
    • Mannosyl (alpha 1,6) glycoprotein beta 1,6 N acetyl glucosaminyltransferase
    • Mgat5
    • MGT5A_HUMAN
    • N acetylglucosaminyl transferase V
    • N acetylglucosaminyltransferase V mannosyl (alpha 1,6) glycoprotein
    • N-acetylglucosaminyl-transferase V
    see all
  • Function
    Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 18 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Recombinant Human MGAT5 protein images

  • 12.5% SDS-PAGE showing ab114713 at approximately 36.41 kDa stained with Coomassie Blue.

References for Recombinant Human MGAT5 protein (ab114713)

ab114713 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up