Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAV AGAAGGARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDD YKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPKE VSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSFAHAQVSITN EIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWT GPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSED STVSIQIKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSR QVAHSGAKASVVDGTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTT LTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMD TDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTA EPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSI MSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGAND LFFQPPPLTPTSKVYTIRPYFPKDEASVYKICREMYDDGVGLPFQSQPDL IGDKLVGGLLSLSLDYCFVLEDEDGICGYALGTVDVTPFIKKCKISWIPF MQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKMDIHKK VTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA KMEGFPKDVVILGRSL
    • Amino acids
      1 to 916
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta-hexosaminidase
    • Beta-N-acetylglucosaminidase
    • Beta-N-acetylhexosaminidase
    • Bifunctional protein NCOAT
    • HEXC
    • Hyaluronidase in meningioma
    • KIAA0679
    • MEA5
    • Meningioma expressed antigen 5
    • Meningioma-expressed antigen 5
    • MGEA 5
    • Mgea5
    • N-acetyl-beta-D-glucosaminidase
    • N-acetyl-beta-glucosaminidase
    • NCOAT
    • Nuclear cytoplasmic O GlcNAcase and acetyltransferase
    • Nuclear cytoplasmic O-GlcNAcase and acetyltransferase
    • OGA
    • OGA_HUMAN
    • Protein O-GlcNAcase
    see all
  • Function
    Isoform 1: Cleaves GlcNAc but not GalNAc from O-glycosylated proteins. Can use p-nitrophenyl-beta-GlcNAc and 4-methylumbelliferone-GlcNAc as substrates but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc (in vitro) (PubMed:11148210). Does not bind acetyl-CoA and does not have histone acetyltransferase activity (PubMed:24088714).
    Isoform 3: Cleaves GlcNAc but not GalNAc from O-glycosylated proteins. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc (in vitro), but has about six times lower specific activity than isoform 1.
  • Tissue specificity
    Ubiquitous. Shows highest expression in the brain, placenta and pancreas.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 84 family.
  • Post-translational
    modifications
    Proteolytically cleaved by caspase-3 during apoptosis. The fragments interact with each other; cleavage does not decrease enzyme activity.
  • Cellular localization
    Cytoplasm and Nucleus.
  • Information by UniProt

Images

  • ab153117 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up