Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHE IKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAV GGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 207
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris-HCl buffer, 0.03% EDTA

General Info

  • Alternative names
    • 6 O methylguanine DNA methyltransferase
    • 6-O-methylguanine-DNA methyltransferase
    • Agat
    • AGT
    • AI267024
    • EC 2.1.1.63
    • Methylated DNA protein cysteine methyltransferase
    • Methylated-DNA--protein-cysteine methyltransferase
    • Methylguanine DNA methyltransferase
    • MGC107020
    • MGMT
    • MGMT_HUMAN
    • O 6 methylguanine DNA alkyltransferase
    • O 6 methylguanine DNA methyltransferase
    • O-6-methylguanine-DNA methyltransferase
    • O-6-methylguanine-DNA-alkyltransferase
    see all
  • Function
    Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
  • Sequence similarities
    Belongs to the MGMT family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab185395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up