Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP08493
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMYESHESMESYELNPFINRRNANTFISPQQ RWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYF
    • Molecular weight12 kDa including tags
    • Amino acids20 to 96
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab113156 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Cell growth inhibiting gene 36 protein
    • Cell growth-inhibiting gene 36 protein
    • GAMMA-CARBOXYGLUTAMIC ACID PROTEIN, MATRIX
    • GIG36
    • Matrix Gla protein
    • MGLAP
    • MGP
    • MGP_HUMAN
    • NTI
    see all
  • FunctionAssociates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
  • Involvement in diseaseDefects in MGP are the cause of Keutel syndrome (KS) [MIM:245150]. KS is an autosomal recessive disorder characterized by abnormal cartilage calcification, peripheral pulmonary stenosis neural hearing loss and midfacial hypoplasia.
  • Sequence similaritiesBelongs to the osteocalcin/matrix Gla protein family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications
    Requires vitamin K-dependent gamma-carboxylation for its function.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human MGP protein images

  • 15% SDS-PAGE showing ab113156 (3 µg) at approximately 11.8 kDa.

References for Recombinant Human MGP protein (ab113156)

ab113156 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"