Recombinant Human MHC Class II beta protein (ab114224)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGRQECYAFNGT QRFLERYIYNREEYARFDSDVGEFR AVTELGRPAAEYWNSQKDILEEK RAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTD FY PGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGD VYICQVEHTSLDSPVTVEWKAQSDSAQSK TLTGAGGFVLGLIICGVGI FMHRRSKKVQRGSA
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 258

Specifications

Our Abpromise guarantee covers the use of ab114224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DPB1
    • HLA-DP
    • HLA-DP1B
    • HLA-DPB
    • Major Histocompatibility Complex Class II beta
    see all
  • Relevance
    Major Histocompatibility Class II molecules are primarily expressed on B-cells and antigen presenting cells (APCs). They are composed of two polypeptide chains. These polypeptides (alpha and beta) are about 230 and 240 amino acids long, respectively, and are glycosylated. These polypeptides fold into two separate domains; the non-polymorphic alpha chain and the polymorphic beta chain. The antigen binding region of the molecule is bounded by a beta-pleated sheet on the bottom and two alpha helices on the sides, and is capable of binding (via non-covalent interactions) a small peptide of about 10 amino acids.
  • Cellular localization
    Cell Membrane

Images

  • ab114224 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up