Recombinant Human MHC Class II beta protein (ab114224)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP04440
    • SpeciesHuman
    • SequenceMMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGRQECYAFNGT QRFLERYIYNREEYARFDSDVGEFR AVTELGRPAAEYWNSQKDILEEK RAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTD FY PGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGD VYICQVEHTSLDSPVTVEWKAQSDSAQSK TLTGAGGFVLGLIICGVGI FMHRRSKKVQRGSA
    • Molecular weight54 kDa including tags
    • Amino acids1 to 258

Specifications

Our Abpromise guarantee covers the use of ab114224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DPB1
    • HLA-DP
    • HLA-DP1B
    • HLA-DPB
    • Major Histocompatibility Complex Class II beta
    see all
  • RelevanceMajor Histocompatibility Class II molecules are primarily expressed on B-cells and antigen presenting cells (APCs). They are composed of two polypeptide chains. These polypeptides (alpha and beta) are about 230 and 240 amino acids long, respectively, and are glycosylated. These polypeptides fold into two separate domains; the non-polymorphic alpha chain and the polymorphic beta chain. The antigen binding region of the molecule is bounded by a beta-pleated sheet on the bottom and two alpha helices on the sides, and is capable of binding (via non-covalent interactions) a small peptide of about 10 amino acids.
  • Cellular localizationCell Membrane

Recombinant Human MHC Class II beta protein images

  • ab114224 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MHC Class II beta protein (ab114224)

ab114224 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"