Overview

  • Product name
    Recombinant Human MIA40 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN WNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQK YPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
    • Amino acids
      1 to 142
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHCHD4
    • Coiled coil helix coiled coil helix domain containing 4
    • Coiled coil helix coiled coil helix domain containing protein 4
    • Coiled-coil-helix-coiled-coil-helix domain-containing protein 4
    • FLJ31709
    • MIA40_HUMAN
    • Mitochondrial intermembrane space import and assembly 40 homolog
    • Mitochondrial intermembrane space import and assembly protein 40
    • TIMM40
    • Translocase of inner mitochondrial membrane 40 homolog
    see all
  • Function
    Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Probably acts by forming a redox cycle with GFER/ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS.
  • Tissue specificity
    Expressed in all tissues tested, suggesting an ubiquitous expression.
  • Sequence similarities
    Contains 1 CHCH domain.
  • Domain
    The CHCH domain contains a conserved twin Cys-X(9)-Cys motif which is required for import and stability of MIA40 in mitochondria.
  • Post-translational
    modifications
    Forms intrachain disulfide bridges, but exists in different redox states.
  • Cellular localization
    Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • ab165346 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up