Recombinant Human MICAL1 protein (ab163879)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREEN LKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
    • Amino acids
      971 to 1067
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CasL interacting molecule
    • DKFZp434B1517
    • FLJ11937
    • FLJ21739
    • MICA1_HUMAN
    • MICAL
    • MICAL 1
    • MICAL1
    • microtubule associated monoxygenase, calponin and LIM domain containing 1
    • Molecule interacting with CasL protein 1
    • NEDD9 interacting protein with calponin homology and LIM domains
    • NEDD9-interacting protein with calponin homology and LIM domains
    • NICAL
    • OTTHUMP00000016969
    see all
  • Function
    May be a cytoskeletal regulator that connects NEDD9 to intermediate filaments.
  • Tissue specificity
    Expressed in the thymus, lung, spleen, kidney, testis and hematopoietic cells.
  • Sequence similarities
    Contains 1 CH (calponin-homology) domain.
    Contains 1 LIM zinc-binding domain.
  • Domain
    The C-terminal coiled coil part contains the plexin-interacting region.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab163879 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up