Recombinant Human Microsomal Glutathione S-transferase 1 protein (ab114792)

Overview

  • Product name
    Recombinant Human Microsomal Glutathione S-transferase 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDC VAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDP STAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLK SKLYL
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 155

Specifications

Our Abpromise guarantee covers the use of ab114792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGST1
    • Glutathione S transferase 12
    • GST12
    • MGST
    • MGST 1
    • MGST I
    • MGST1
    • MGST1_HUMAN
    • Microsomal glutathione S-transferase 1
    • Microsomal GST 1
    • Microsomal GST-1
    • Microsomal GST-I
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity.
  • Tissue specificity
    Highly expressed in liver.
  • Sequence similarities
    Belongs to the MAPEG family.
  • Post-translational
    modifications
    Peroxynitrite induces nitration at Tyr-93 which activates the enzyme.
  • Cellular localization
    Microsome. Mitochondrion outer membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human Microsomal Glutathione S-transferase 1 protein images

  • ab114792 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Microsomal Glutathione S-transferase 1 protein (ab114792)

ab114792 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up