Recombinant Human Microsomal Glutathione S-transferase 1 protein (ab114792)

Overview

  • Product name
    Recombinant Human Microsomal Glutathione S-transferase 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDC VAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDP STAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLK SKLYL
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 155

Specifications

Our Abpromise guarantee covers the use of ab114792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGST1
    • Glutathione S transferase 12
    • GST12
    • MGST
    • MGST 1
    • MGST I
    • MGST1
    • MGST1_HUMAN
    • Microsomal glutathione S-transferase 1
    • Microsomal GST 1
    • Microsomal GST-1
    • Microsomal GST-I
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity.
  • Tissue specificity
    Highly expressed in liver.
  • Sequence similarities
    Belongs to the MAPEG family.
  • Post-translational
    modifications
    Peroxynitrite induces nitration at Tyr-93 which activates the enzyme.
  • Cellular localization
    Microsome. Mitochondrion outer membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab114792 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up