Overview

  • Product name
    Recombinant Human MICS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTR IGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYG LGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPV LMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVM GAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGV GLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIK RAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
    • Amino acids
      1 to 345
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dermal papilla derived protein 2
    • Dermal papilla-derived protein 2
    • DERP2
    • Ghitm
    • GHITM_HUMAN
    • Growth hormone inducible transmembrane protein
    • Growth hormone-inducible transmembrane protein
    • HSPC282
    • MICS1
    • Mitochondrial morphology and cristae structure 1
    • My021
    • PTD010
    • TMBIM5
    • Transmembrane BAX inhibitor motif containing 5
    • Transmembrane BAX inhibitor motif containing protein 5
    • Transmembrane BAX inhibitor motif-containing protein 5
    see all
  • Function
    Required for the mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c.
  • Sequence similarities
    Belongs to the BI1 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab162068 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up