Overview

  • Product nameRecombinant Human MID1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15344
    • SpeciesHuman
    • SequencePNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLKTNSQPFKLDP KSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
    • Molecular weight37 kDa including tags
    • Amino acids441 to 540

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BBBG 1
    • BBBG1
    • E3 ubiquitin-protein ligase Midline-1
    • Finger on X and Y mouse homolog of
    • FXY
    • GBBB 1
    • GBBB1
    • MID 1
    • Mid1
    • Midin
    • Midline 1
    • Midline 1 (Opitz/BBB syndrome)
    • Midline 1 ring finger
    • Midline 1 RING finger protein
    • Midline-1
    • Midline1
    • OGS 1
    • OGS1
    • OS
    • OSX
    • Putative transcription factor XPRF
    • RING finger protein 59
    • RING finger protein Midline-1
    • RNF 59
    • RNF59
    • TRI18
    • TRI18_HUMAN
    • TRIM 18
    • TRIM18
    • Tripartite motif containing protein 18
    • Tripartite motif protein TRIM18
    • Tripartite motif-containing protein 18
    • XPRF
    • zinc finger on X and Y, mouse, homolog of
    • Zinc finger X and Y
    • ZNFXY
    see all
  • FunctionMay have E3 ubiquitin ligase activity which targets the catalytic subunit of protein phosphatase 2 for degradation.
  • Tissue specificityIn the fetus, highest expression found in kidney, followed by brain and lung. Expressed at low levels in fetal liver. In the adult, most abundant in heart, placenta and brain.
  • Involvement in diseaseDefects in MID1 are the cause of Opitz syndrome type I (OS-I) [MIM:300000]. OS-I is an X-linked recessive disorder characterized by hypertelorism, genital-urinary defects such as hypospadias in males and splayed labia in females, lip-palate-laryngotracheal clefts, imperforate anus, developmental delay and congenital heart defects. OS-I mutations produce proteins with a decreased affinity for microtubules.
  • Sequence similaritiesBelongs to the TRIM/RBCC family.
    Contains 2 B box-type zinc fingers.
    Contains 1 B30.2/SPRY domain.
    Contains 1 COS domain.
    Contains 1 fibronectin type-III domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > spindle. Microtubule-associated. It is associated with microtubules throughout the cell cycle, co-localizing with cytoplasmic fibers in interphase and with the mitotic spindle and midbodies during mitosis and cytokinesis.
  • Information by UniProt

Recombinant Human MID1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114762 at approximately 36.63kDa.

References for Recombinant Human MID1 protein (ab114762)

ab114762 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"