Recombinant Human MID1IP1 protein (ab163693)

Overview

  • Product name
    Recombinant Human MID1IP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDN DVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRND IEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYH LRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
    • Amino acids
      1 to 183
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3110038L01Rik
    • FLJ10386
    • G12 like
    • Gastrulation specific G12 like protein
    • Gastrulation-specific G12-like protein
    • M1IP1_HUMAN
    • MGC72582
    • MID1 interacting G12 like protein
    • MID1 interacting protein 1 (gastrulation specific G12 like)
    • Mid1-interacting G12-like protein
    • Mid1-interacting protein 1
    • Mid1ip1
    • MIG12
    • OTTMUSP00000018143
    • OTTMUSP00000018222
    • OTTMUSP00000018284
    • OTTMUSP00000018285
    • Protein STRAIT11499
    • Protein STRAIT11499 homolog
    • RP23-130J1.1
    • S14R
    • Slap
    • Spot 14 like androgen inducible protein
    • Spot 14 related protein
    • Spot 14-R
    • Spot 14-related protein
    • STRAIT11499
    • THRSPL
    see all
  • Function
    Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules.
  • Sequence similarities
    Belongs to the SPOT14 family.
  • Cellular localization
    Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Associated with microtubules.
  • Information by UniProt

Images

  • ab163693 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up