Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEP ITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSES RRERTYRPTTAMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRATH PNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKL VGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQ VEVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVA NCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATASSQVLI PDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTIT VHWISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTV HGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKIS NDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSS TWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPH LKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMI LSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH
    • Molecular weight
      104 kDa including tags
    • Amino acids
      21 to 705

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ37715
    • FLJ41813
    • FXY2
    • MID2
    • Midin 2
    • Midin-2
    • Midline 2
    • Midline defect 2
    • Midline-2
    • probable E3 ubiquitin protein ligase MID2
    • Probable E3 ubiquitin-protein ligase MID2
    • RING finger protein 60
    • Ring finger protein protein 60
    • RNF60
    • TRIM1
    • TRIM1_HUMAN
    • tripartite motif containing protein 1
    • Tripartite motif protein 1
    • Tripartite motif-containing protein 1
    see all
  • Tissue specificity
    Low level in fetal kidney and lung, and in adult prostate, ovary and small intestine.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 2 B box-type zinc fingers.
    Contains 1 B30.2/SPRY domain.
    Contains 1 COS domain.
    Contains 1 fibronectin type-III domain.
    Contains 1 RING-type zinc finger.
  • Domain
    The tripartite motif (RBCC; RING- and B box-type zinc fingers and coiled coil domains) mediates dimerization.
    Associates with microtubules in a manner that is dependent on the C-terminal B30.2 domain.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Microtubule-associated.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132138 stained with Coomassie Blue.

References

ab132138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up