Overview

  • Product name
    Recombinant Human MIER1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEE EGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQD AQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIP VGICRY
    • Amino acids
      1 to 156
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ER1
    • Mesoderm induction early response 1
    • Mesoderm induction early response 1 homolog (Xenopus laevis)
    • MI-ER1
  • Relevance
    MIER1 (previously called er1) was first isolated from Xenopus laevis embryonic cells as a novel fibroblast growth factor. Human MIER1 (hMIER1) was shown to encode a nuclear protein with an N terminal acidic transcription activation domain. The human orthologue of MIER1 displays 91% similarity to the Xenopus sequence at the amino acid level and was shown to be upregulated in breast carcinoma cell lines and tumors. Alternative splicing at the 3' end of hMIER1 produces two major isoforms, hMIER1 and hMIER1ß, which contain distinct C terminal domains. The association of hMIER1 with Sp1 represents a novel mechanism for the negative regulation of Sp1 target promoters. Results demonstrate that alternate use of a facultative intron regulates the subcellular localization of hMIER1 proteins and this may have important implications for hMIER1 function in the regulation of transcription. Repressor activity is due to interaction and recruitment of a trichostatin A sensitive histone deacetylase 1 (HDAC1).
  • Cellular localization
    Nuclear

Images

  • ab163633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up