Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAF GGS SEPALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINY YDMNAANVG WNNSTF- ALEHHHHHH
    • Molecular weight14 kDa
    • Additional sequence informationMIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Specifications

Our Abpromise guarantee covers the use of ab73230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    Purified to apparent homogeneity by using conventional column chromatography techniques. Purity greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • FormLyophilised
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: PBS, pH 7.4

  • ReconstitutionReconstitute the lyophilized MIF in sterile 18Mohm-cm water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • acrophage migration inhibitory factor (glycosylation-inhibiting factor)
    • GIF
    • GLIF
    • Glycosylation inhibiting factor
    • Glycosylation-inhibiting factor
    • L-dopachrome isomerase
    • L-dopachrome tautomerase
    • Macrophage migration inhibitory factor
    • MIF
    • MIF protein
    • MIF_HUMAN
    • MMIF
    • Phenylpyruvate tautomerase
    see all
  • FunctionPro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
  • Involvement in diseaseGenetic variations in MIF are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
  • Sequence similaritiesBelongs to the MIF family.
  • Cellular localizationSecreted. Cytoplasm. Does not have a cleavable signal sequence and is secreted via a specialized, non-classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens.
  • Information by UniProt

References for Recombinant Human MIF protein (ab73230)

ab73230 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"