Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSTPVVRKGRCSCISTNQGTIHLQSLKDL KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQ KNGKKHQKKKVLKVRKSQRSRQKKTT
    • Molecular weight
      14 kDa including tags
    • Amino acids
      23 to 125
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab167829 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • C-X-C motif chemokine 9
    • chemokine (C-X-C motif) ligand 9
    • CMK
    • crg-10
    • CXCL9
    • CXCL9_HUMAN
    • gamma interferon induced monokine
    • Gamma-interferon-induced monokine
    • HuMIG
    • MIG
    • monokine induced by gamma interferon
    • monokine induced by interferon gamma
    • Monokine induced by interferon-gamma
    • SCYB9
    • Small inducible cytokine B9
    • small inducible cytokine subfamily B member 9
    • Small-inducible cytokine B9
    see all
  • Function
    Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab167829.

References

ab167829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up