Recombinant Human Milk Fat Globule 1 protein (ab158881)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVF PSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQH WVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLA SHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPV EAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASS SYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVT GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
    • Amino acids
      1 to 387
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BA46
    • Breast epithelial antigen BA46
    • EDIL1
    • HMFG
    • hP47
    • HsT19888
    • Lactadherin
    • Medin
    • MFG-E8
    • MFGE8
    • MFGM
    • MFGM_HUMAN
    • Milk fat globule EGF factor 8
    • Milk fat globule EGF factor 8 protein
    • Milk fat globule-EGF factor 8
    • O acetyl disialoganglioside synthase
    • OAcGD3S
    • SED1
    • SPAG10
    • Sperm associated antigen 10
    • Sperm surface protein hP47
    see all
  • Function
    Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.
    Medin is the main constituent of aortic medial amyloid.
  • Tissue specificity
    Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
  • Sequence similarities
    Contains 1 EGF-like domain.
    Contains 2 F5/8 type C domains.
  • Post-translational
    modifications
    Medin has a ragged N-terminus with minor species starting at Pro-264 and Gly-273.
  • Cellular localization
    Membrane. Secreted.
  • Information by UniProt

Images

  • ab158881 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up