Recombinant Human Mimitin protein (ab109967)

Overview

  • Product nameRecombinant Human Mimitin protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8N183
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGN KYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRK TPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIK GHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
    • Molecular weight22 kDa including tags
    • Amino acids1 to 169
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab109967 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • B17.2 like
    • B17.2-like
    • B17.2L
    • FLJ22398
    • MIMIT_HUMAN
    • Mimitin
    • Mimitin mitochondrial
    • mitochondrial
    • MMTN
    • Myc induced mitochondrial protein
    • Myc-induced mitochondrial protein
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2
    • NADH dehydrogenase (ubiquinone) complex I, assembly factor 2
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
    • NDUFA12 like
    • NDUFA12 like protein
    • NDUFA12-like protein
    • NDUFA12L
    • NDUFAF2
    • OTTHUMP00000161882
    • OTTHUMP00000221703
    see all
  • FunctionActs as a molecular chaperone for mitochondrial complex I assembly.
  • Tissue specificityHighly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts.
  • Involvement in diseaseDefects in NDUFAF2 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similaritiesBelongs to the complex I NDUFA12 subunit family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human Mimitin protein images

  • 15% SDS-PAGE analysis of 3 µg ab109967.

References for Recombinant Human Mimitin protein (ab109967)

ab109967 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"