Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRM ELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAH GLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRL
    • Molecular weight
      15 kDa
    • Amino acids
      1 to 138
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • Adapter protein X11gamma
    • amyloid beta (A4) precursor protein binding, family A, member 3
    • Amyloid beta A4 precursor protein-binding family A member 3
    • Amyloid beta precursor protein binding, family A, member 3 phosphotyrosine binding/ interacting domain (PTB) bearing protein
    • APBA3
    • APBA3_HUMAN
    • lin 10
    • MGC:15815
    • Mint 3
    • Mint-3
    • Neuron specific X11L2 protein
    • Neuron-specific X11L2 protein
    • Neuronal Munc18 1 interacting protein 3
    • Neuronal Munc18-1-interacting protein 3
    • phosphotyrosine binding/interacting domain (PTB) bearing protein
    • X11 like 2 protein 2
    • X11gamma
    • X11L2
    see all
  • Function
    May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP. May enhance the activity of HIF1A in macrophages by inhibiting the activity of HIF1AN.
  • Tissue specificity
    Expressed in all tissues examined with lower levels in brain and testis.
  • Sequence similarities
    Contains 2 PDZ (DHR) domains.
    Contains 1 PID domain.
  • Domain
    Composed of an N-terminal domain, a middle phosphotyrosine-binding domain (PID/PTB) that mediates binding with the cytoplasmic domain of the beta-amyloid precursor protein, and two C-terminal PDZ domains thought to attach proteins to the plasma membrane.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt

References

ab153767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up