Overview

  • Product name
    Recombinant Human MIOX protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTH QTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAF QTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRP QASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQ VMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFN KFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
    • Amino acids
      1 to 285
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0610009I10Rik
    • AI314022
    • Aldehyde reductase-like 6
    • ALDRL6
    • C85427
    • Inositol oxygenase
    • Kidney-specific protein 32
    • KSP32
    • MGC90217
    • MI oxygenase
    • miox
    • MIOX_HUMAN
    • Myo-inositol oxygenase
    • Renal-specific oxidoreductase
    • RSOR
    see all
  • Tissue specificity
    Kidney specific.
  • Pathway
    Polyol metabolism; myo-inositol degradation into D-glucuronate; D-glucuronate from myo-inositol: step 1/1.
  • Sequence similarities
    Belongs to the myo-inositol oxygenase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163131 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up