Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER VPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPL INERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAK NLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDN DGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKG FLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVC TNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVT VTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIR EDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICDVVCLVYDVSN PKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHK MPPPQAFTCNTADAPSKDIFVKLTTMAMYPHARLRCMCTCNRCTFCICQN FLNSDLLQSVKNKIFTAVLNRHVTQADLKSSTFWLRASFGATVFAVLGFA MYKALLKQR
    • Amino acids
      1 to 659
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHT 1
    • ARHT1
    • FLJ11040
    • FLJ12633
    • hMiro 1
    • hMiro-1
    • hMiro1
    • MIRO 1
    • MIRO-1
    • MIRO1
    • MIRO1_HUMAN
    • mitochondrial Rho (MIRO) GTPase 1
    • Mitochondrial Rho 1
    • Mitochondrial Rho GTPase 1
    • Mitochondrial Rho1
    • Rac GTP binding protein like protein
    • Rac-GTP-binding protein-like protein
    • Ras homolog family member T1
    • Ras homolog gene family member T1
    • Rhot 1
    • RHOT1
    see all
  • Function
    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity
    Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization
    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt

Images

  • ab163047 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up