Recombinant Human Mitofusin 1 protein (ab153407)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIAT EDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fzo homolog
    • Hfzo1
    • Hfzo2
    • MFN 1
    • Mfn1
    • MFN1_HUMAN
    • Mitochondrial transmembrane GTPase Fzo 1
    • Mitochondrial transmembrane GTPase FZO 2
    • Mitochondrial transmembrane GTPase FZO1B
    • Mitofusin 1
    • Mitofusin-1
    • Mitofusin1
    • MS996
    • Putative transmembrane GTPase
    • Transmembrane GTPase MFN1
    see all
  • Function
    Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN1 acts independently of the cytoskeleton. Overexpression induces the formation of mitochondrial networks.
  • Tissue specificity
    Ubiquitous. Expressed at slightly higher level in kidney and heart. Isoform 2 may be overexpressed in some tumors, such as lung cancers.
  • Sequence similarities
    Belongs to the mitofusin family.
  • Post-translational
    modifications
    Ubiquitinated by MARCH5.
  • Cellular localization
    Cytoplasm and Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab153407 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up