Recombinant Human Mitofusin 2 protein (ab153026)

Overview

  • Product name
    Recombinant Human Mitofusin 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENL EQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
    • Amino acids
      661 to 757
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab153026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CMT2A
    • CMT2A2
    • CPRP 1
    • CPRP1
    • EC 3.6.5.-
    • Fzo
    • HSG
    • hyperplasia suppressor gene
    • Hypertension related protein 1
    • KIAA0214
    • MARF
    • MFN 2
    • Mfn2
    • MFN2_HUMAN
    • Mitochondrial assembly regulatory factor
    • Mitofusin-2
    • Mitofusin2
    • Transmembrane GTPase MFN2
    see all
  • Function
    Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PARK2 recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions.
  • Tissue specificity
    Ubiquitous; expressed at low level. Highly expressed in heart and kidney.
  • Involvement in disease
    Charcot-Marie-Tooth disease 2A2
    Neuropathy, hereditary motor and sensory, 6A
  • Sequence similarities
    Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family. Mitofusin subfamily.
    Contains 1 dynamin-type G (guanine nucleotide-binding) domain.
  • Post-translational
    modifications
    Phosphorylated by PINK1.
    Ubiquitinated by non-degradative ubiquitin by PARK2, promoting mitochondrial fusion; deubiquitination by USP30 inhibits mitochondrial fusion.
  • Cellular localization
    Mitochondrion outer membrane. Colocalizes with BAX during apoptosis.
  • Information by UniProt

Images

  • ab153026 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up