Overview

  • Product name
    Recombinant Human Miz1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDFPQHSQHVLEQLNQQRQLGLLCDCTFVV DGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTA KLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALAT EGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA EQTEKADA
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 188
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.25
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • Miz-1
    • Myc-interacting zinc finger protein
    • Myc-interacting zinc finger protein 1
    • ZBT17
    • ZBT17_HUMAN
    • Zbtb17
    • Zinc finger and BTB domain containing protein 17
    • Zinc finger and BTB domain-containing protein 17
    • Zinc finger protein 151
    • Zinc finger protein 60
    • ZNF151
    • ZNF60
    see all
  • Function
    May function as a housekeeping DNA-binding protein that regulates the expression of specific genes. Has been shown to bind to the promoters of adenovirus major late protein and cyclin D1 and activate transcription. Also has potent growth arrest activity, probably through inhibition of cell cycle progression. Required for early embryonic development during gastrulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 13 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab151354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up