Overview

  • Product name
    Recombinant Human Mkln1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLA SALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDL ITL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      633 to 735

Specifications

Our Abpromise guarantee covers the use of ab114771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MKLN 1
    • Mkln1
    • MKLN1_HUMAN
    • Muskelin
    • muskelin 1, intracellular mediator containing kelch motifs
    • TWA2
    • Two-hybrid-associated protein with Ranbpm 2
    see all
  • Function
    Acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin 1.
  • Sequence similarities
    Contains 1 CTLH domain.
    Contains 6 Kelch repeats.
    Contains 1 LisH domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Mkln1 protein images

  • ab114771 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Mkln1 protein (ab114771)

ab114771 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up