Overview

  • Product name
    Recombinant Human Mkln1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLA SALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDL ITL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      633 to 735

Specifications

Our Abpromise guarantee covers the use of ab114771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MKLN 1
    • Mkln1
    • MKLN1_HUMAN
    • Muskelin
    • muskelin 1, intracellular mediator containing kelch motifs
    • TWA2
    • Two-hybrid-associated protein with Ranbpm 2
    see all
  • Function
    Acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin 1.
  • Sequence similarities
    Contains 1 CTLH domain.
    Contains 6 Kelch repeats.
    Contains 1 LisH domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114771 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up