Recombinant Human MLC1SA protein (ab111637)

Overview

  • Product nameRecombinant Human MLC1SA protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP14649
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAA GAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFD RVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETF LPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM TEEEVETVLAGHEDSNGCINYEAFLKHILSV
    • Molecular weight25 kDa including tags
    • Amino acids1 to 208
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab111637 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.32% Tris-HCl buffer

General Info

  • Alternative names
    • MLC1sa
    • MYL 6B
    • Myl6b
    • MYL6B_HUMAN
    • Myosin alkali light chain 1 slow a
    • Myosin light chain 1 slow a
    • Myosin light chain 1 slow twitch muscle A isoform
    • Myosin light chain 1 slow-twitch muscle A isoform
    • Myosin light chain 6B
    • Myosin light chain 6B alkali smooth muscle and non muscle
    • Myosin light polypeptide 6B
    • Myosin light polypeptide 6B alkali smooth muscle and non muscle
    • Smooth muscle and non muscle myosin alkali light chain 6B
    • Smooth muscle and nonmuscle myosin light chain alkali 6B
    see all
  • FunctionRegulatory light chain of myosin. Does not bind calcium.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Information by UniProt

Recombinant Human MLC1SA protein images

  • 15% SDS-PAGE analysis of ab111637 (3 µg)

References for Recombinant Human MLC1SA protein (ab111637)

ab111637 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"