Recombinant Human MLC1SA protein (ab111637)

Overview

  • Product name
    Recombinant Human MLC1SA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAA GAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFD RVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETF LPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM TEEEVETVLAGHEDSNGCINYEAFLKHILSV
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 208
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab111637 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.32% Tris-HCl buffer

General Info

  • Alternative names
    • MLC1sa
    • MYL 6B
    • Myl6b
    • MYL6B_HUMAN
    • Myosin alkali light chain 1 slow a
    • Myosin light chain 1 slow a
    • Myosin light chain 1 slow twitch muscle A isoform
    • Myosin light chain 1 slow-twitch muscle A isoform
    • Myosin light chain 6B
    • Myosin light chain 6B alkali smooth muscle and non muscle
    • Myosin light polypeptide 6B
    • Myosin light polypeptide 6B alkali smooth muscle and non muscle
    • Smooth muscle and non muscle myosin alkali light chain 6B
    • Smooth muscle and nonmuscle myosin light chain alkali 6B
    see all
  • Function
    Regulatory light chain of myosin. Does not bind calcium.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab111637 (3 µg)

References

ab111637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up