Overview

  • Product nameRecombinant Human MLLT6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP55198
    • SpeciesHuman
    • SequenceMGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFD QTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQK ENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGL PPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFH STPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMA EGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNS LTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQ RLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPS LGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGT ADKGASANQEKG
    • Molecular weight77 kDa including tags
    • Amino acids1 to 462

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF 17
    • AF17
    • AF17_HUMAN
    • ALL1-fused gene from chromosome 17 protein
    • FLJ23480
    • MLLT 6
    • MLLT6
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog) translocated to 6
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila) translocated to 6
    • Myeloid/lymphoid or mixed lineage leukemia translocated to 6
    • OTTHUMP00000164158
    • Protein AF 17
    • Protein AF-17
    • Trithorax homolog
    see all
  • Involvement in diseaseNote=A chromosomal aberration involving MLLT6 is associated with acute leukemias. Translocation t(11;17)(q23;q21) with MLL/HRX. The result is a rogue activator protein.
  • Sequence similaritiesContains 2 PHD-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MLLT6 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117030 at approximately 76.93 kDa.

References for Recombinant Human MLLT6 protein (ab117030)

ab117030 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"