Overview

  • Product name
    Recombinant Human MLLT6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFD QTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQK ENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGL PPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFH STPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMA EGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNS LTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQ RLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPS LGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGT ADKGASANQEKG
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 462

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF 17
    • AF17
    • AF17_HUMAN
    • ALL1-fused gene from chromosome 17 protein
    • FLJ23480
    • MLLT 6
    • MLLT6
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog) translocated to 6
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila) translocated to 6
    • Myeloid/lymphoid or mixed lineage leukemia translocated to 6
    • OTTHUMP00000164158
    • Protein AF 17
    • Protein AF-17
    • Trithorax homolog
    see all
  • Involvement in disease
    Note=A chromosomal aberration involving MLLT6 is associated with acute leukemias. Translocation t(11;17)(q23;q21) with MLL/HRX. The result is a rogue activator protein.
  • Sequence similarities
    Contains 2 PHD-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117030 at approximately 76.93 kDa.

References

ab117030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up