Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVR RTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFV LAFFRFSGLLLGYAVLQLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAF GYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSG ALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVD QILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEV ILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNV RRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVC TFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA
    • Amino acids
      1 to 445
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAB 1
    • CAB1
    • Es 64
    • Es64
    • FLJ41370
    • Metastatic lymph node gene 64 protein
    • Metastatic lymph node protein 64
    • MLN 64
    • Mln64
    • Protein CAB 1
    • Protein CAB1
    • Protein MLN 64
    • Protein MLN64
    • StAR related lipid transfer protein 3
    • StAR-related lipid transfer protein 3
    • STAR3_HUMAN
    • STARD 3
    • StARD3
    • START domain containing 3
    • START domain-containing protein 3
    • Steroidogenic acute regulatory protein related
    see all
  • Function
    Binds and transports cholesterol. Promotes steroidogenesis in placenta and brain.
  • Sequence similarities
    Contains 1 MENTAL domain.
    Contains 1 START domain.
  • Cellular localization
    Late endosome membrane.
  • Information by UniProt

Images

  • ab153143 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up