Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LSVPRGCREDSSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIG STSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      50 to 150

Specifications

Our Abpromise guarantee covers the use of ab116726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • bHLHd13
    • BigMax protein
    • Class D basic helix-loop-helix protein 13
    • MAD7
    • Max like bHLHZip protein
    • Max like protein X
    • Max-like bHLHZip protein
    • Max-like protein X
    • MLX
    • MLX_HUMAN
    • MLXIP
    • MONDOA
    • MXD7
    • Protein BigMax
    • Protein Mlx
    • TCFL4
    • transcription factor like 4
    • Transcription factor like protein 4
    • Transcription factor-like protein 4
    see all
  • Function
    Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repressors. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation.
  • Tissue specificity
    Expressed in all tissues tested, including spleen, thymus, prostate, ovary, intestine, colon, peripheral blood leukocyte, heart, liver, skeletal muscle and kidney. Lower levels of expression in testis, brain, placenta and lung.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Cytoplasm. Found predominantly in the cytoplasm and Nucleus. Found predominantly in the nucleus.
  • Information by UniProt

Recombinant Human MLX protein images

  • 12.5% SDS-PAGE showing ab116726 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human MLX protein (ab116726)

ab116726 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up