Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPMLLPHPHQHFLKGLLRAPFRCYHFIFHSSTHLGSGIPCAQPFNSLGLH CTKWMLLSDGLKRKLCVQTTLKDHTEGLSDKEQRFVDKLYTGLIQGQRAC LAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFRVGLSG PPGAGKSTFIEYFGKMLTERGHKLSVLAVDPSSCTSGGSLLGDKTRMTEL SRDMNAYIRPSPTRGTLGGVTRTTNEAILLCEGAGYDIILIETVGVGQSE FAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVAVTKSDGDLIVPAR RIQAEYVSALKLLRKRSQVWKPKVIRISARSGEGISEMWDKMKDFQDLML ASGELTAKRRKQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGA LSPGLAADFLLKAFKSRD
    • Amino acids
      1 to 418
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cblA
    • Methylmalonic aciduria (cobalamin deficiency) cblA type
    • Methylmalonic aciduria (cobalamin deficiency) type A
    • Methylmalonic aciduria type A protein
    • Methylmalonic aciduria type A protein mitochondrial
    • MGC120010
    • MGC120011
    • MGC120012
    • MGC120013
    • mitochondrial
    • MMAA
    • MMAA_HUMAN
    • OTTHUMP00000220105
    see all
  • Function
    Probable GTPase. May function as chaperone. May be involved in the transport of cobalamin (Cbl) into mitochondria for the final steps of adenosylcobalamin (AdoCbl) synthesis.
  • Tissue specificity
    Widely expressed. Highest expression is observed in liver and skeletal muscle.
  • Pathway
    Cofactor biosynthesis; adenosylcobalamin biosynthesis.
  • Involvement in disease
    Defects in MMAA are the cause of methylmalonic aciduria type cblA (MMAA) [MIM:251100]; also known as methylmalonic aciduria type A or vitamin B12-responsive methylmalonicaciduria of cblA complementation type. MMAA is a disorder of methylmalonate and cobalamin metabolism due to defective synthesis of adenosylcobalamin. Inheritance is autosomal recessive.
  • Sequence similarities
    Belongs to the ArgK family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab165784 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up