Overview

  • Product nameRecombinant Human MMAB protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96EY8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTK TGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFA EELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYT SQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAK FLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL
    • Molecular weight26 kDa including tags
    • Amino acids33 to 250
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99217 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • aquocob(I)alamin vitamin B12s adenosyltransferase
    • ATP:cob(I)alamin adenosyltransferase
    • ATP:corrinoid adenosyltransferase
    • ATR
    • c-diamide adenosyltransferase
    • cblB
    • Cob
    • Cob(I)alamin adenosyltransferase
    • Cob(I)yrinic acid a
    • cob(I)yrinic acid a c diamide adenosyltransferase mitochondrial
    • Methylmalonic aciduria (cobalamin deficiency) cblB type
    • Methylmalonic aciduria type B protein
    • MGC20496
    • mitochondrial
    • MMAB
    • MMAB gene
    • MMAB_HUMAN
    • OTTHUMP00000240563
    • OTTHUMP00000240564
    see all
  • Tissue specificityExpressed in liver and skeletal muscle.
  • PathwayCofactor biosynthesis; adenosylcobalamin biosynthesis; adenosylcobalamin from cob(II)yrinate a,c-diamide: step 2/7.
  • Involvement in diseaseDefects in MMAB are the cause of methylmalonic aciduria type cblB (MMAB) [MIM:251110]; also known as methylmalonic aciduria type B or vitamin B12-responsive methylmalonicaciduria of cblB complementation type. MMAB is a disorder of methylmalonate and cobalamin metabolism due to defective synthesis of adenosylcobalamin. Inheritance is autosomal recessive.
  • Sequence similaritiesBelongs to the Cob(I)alamin adenosyltransferase family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human MMAB protein images

  • 15% SDS-PAGE analysis of 3µg ab99217.

References for Recombinant Human MMAB protein (ab99217)

ab99217 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"