Overview

  • Product name
    Recombinant Human MMAB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTK TGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFA EELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYT SQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAK FLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL
    • Molecular weight
      26 kDa including tags
    • Amino acids
      33 to 250
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99217 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • aquocob(I)alamin vitamin B12s adenosyltransferase
    • ATP:cob(I)alamin adenosyltransferase
    • ATP:corrinoid adenosyltransferase
    • ATR
    • c-diamide adenosyltransferase
    • cblB
    • Cob
    • Cob(I)alamin adenosyltransferase
    • Cob(I)yrinic acid a
    • cob(I)yrinic acid a c diamide adenosyltransferase mitochondrial
    • Methylmalonic aciduria (cobalamin deficiency) cblB type
    • Methylmalonic aciduria type B protein
    • MGC20496
    • mitochondrial
    • MMAB
    • MMAB gene
    • MMAB_HUMAN
    • OTTHUMP00000240563
    • OTTHUMP00000240564
    see all
  • Tissue specificity
    Expressed in liver and skeletal muscle.
  • Pathway
    Cofactor biosynthesis; adenosylcobalamin biosynthesis; adenosylcobalamin from cob(II)yrinate a,c-diamide: step 2/7.
  • Involvement in disease
    Defects in MMAB are the cause of methylmalonic aciduria type cblB (MMAB) [MIM:251110]; also known as methylmalonic aciduria type B or vitamin B12-responsive methylmalonicaciduria of cblB complementation type. MMAB is a disorder of methylmalonate and cobalamin metabolism due to defective synthesis of adenosylcobalamin. Inheritance is autosomal recessive.
  • Sequence similarities
    Belongs to the Cob(I)alamin adenosyltransferase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human MMAB protein images

  • 15% SDS-PAGE analysis of 3µg ab99217.

References for Recombinant Human MMAB protein (ab99217)

ab99217 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up