Overview

  • Product name
    Recombinant Human MMD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLH RLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCD RMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKY KVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGI IPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
    • Amino acids
      1 to 238
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200017E07Rik
    • 1810073C06Rik
    • AA690185
    • Maf
    • MGC94095
    • MMA
    • MMD1
    • Monocyte to macrophage differentiation associated
    • Monocyte to macrophage differentiation protein
    • OTTMUSP00000001266
    • OTTMUSP00000001267
    • PAQR11
    • Progestin and adipoQ receptor family member 11
    • Progestin and adipoQ receptor family member XI
    • RP23-220F20.1
    see all
  • Relevance
    MMD is involved in the dynamics of lysosomal membranes associated with microglial activation following brain lesion.
  • Cellular localization
    Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Images

  • ab161674 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up