Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQE FFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIE NYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHR DNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHE LGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP IGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISV FWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFG FPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDF PGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN HHHHHHHHHH
    • Molecular weight
      53 kDa including tags
    • Amino acids
      20 to 469
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein from aa 20 to 469. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab198437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ≥ 105 pmole/min/µg. 

    Activation: This is a proform enzyme and requires activation prior to testing activity. Dilute the enzyme to 100 ng/ml in a solution containing 50 mM HEPES, pH 7.4, 10 mM CaCl2, 0.05% Brij-35, and 1 mM APMA (amino-phenyl mercuric acetate). Incubate at 37ºC for 2 hours.
    Assay conditions: Reaction mixture with 10 μM 390 MMP substrate 1. Incubate for 30 minutes at room temperature. Fluorescence intensity is measured at exc328/em393.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.64% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 27 kDa interstitial collagenase
    • CLG
    • CLGN
    • collagenase, fibroblast
    • collagenase, interstitial
    • Fibroblast collagenase
    • Interstitial collagenase
    • Matrix metallopeptidase 1 (interstitial collagenase)
    • Matrix metalloprotease 1
    • Matrix Metalloproteinase 1
    • Matrix metalloproteinase-1
    • MMP 1
    • MMP-1
    • MMP1
    • MMP1_HUMAN
    • OTTHUMP00000045866
    see all
  • Function
    Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain
    There are two distinct domains in this protein; the catalytic N-terminal, and the C-terminal which is involved in substrate specificity and in binding TIMP (tissue inhibitor of metalloproteinases).
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    Undergoes autolytic cleavage to two major forms (22 kDa and 27 kDa). A minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • Activity assay of ab198437.

  • 4-20% SDS-PAGE analysis of 2.4 µg ab198437 with Coomassie staining.

References

ab198437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up