Recombinant Human MMP12 protein (ab80209)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKFLLILLLQATASGALPLNSSTSLEKNNVLFG
    • Amino acids
      1 to 33

Specifications

Our Abpromise guarantee covers the use of ab80209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

  • Reconstitution
    Redissolve the powder with 1ml sterile water will restore to the original concentration 1mg/ml.

General Info

  • Alternative names
    • EC 3.4.24.65
    • HME
    • Macrophage elastase
    • Macrophage metalloelastase
    • Macrophage metaloelastase
    • Matrix metallopeptidase 12 (macrophage elastase)
    • Matrix metalloprotease 12
    • Matrix metalloproteinase-12
    • ME
    • MGC138506
    • MME
    • MMP 12
    • MMP-12
    • Mmp12
    • MMP12_HUMAN
    see all
  • Function
    May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3.
  • Tissue specificity
    Found in alveolar macrophages but not in peripheral blood monocytes.
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 30% SDS PAGE showing ab80209 at approximately 8 kDa.

References

ab80209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us. The question for the MMP12 protein has been forwarded from the customer servicesto us in the technical team.

We do have another MMP12 protein in our catalog, it is the ab80209. http://www.abcam.com/index.html?data...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up