Recombinant human MMP14 protein (Proenzyme) (ab168877)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDL RTHTQRSPQS LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDK FGAEIKANVRRKRYAIQGLKWQ HNEITFCIQNYTPKVGEYATYEAIRK AFRVWESATPLRFREVPYAYIREGHEKQADIMIF FAEGFHGDSTPFDG EGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE LG HALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTK MPPQPRTT SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERW FWRVRNNQVMDGYPMPIGQF WRGLPASINTAYERKDGKFVFFKGDKHW VFDEASLEPGYPKHIKELGRGLPTDKIDAALF WMPNGKTYFFRGNKYY RFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG NKYW KFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGG GAVSAA
    • Molecular weight
      58 kDa
    • Amino acids
      1 to 501

Specifications

Our Abpromise guarantee covers the use of ab168877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The proenzyme can be activated with trace amounts of MMP-14 catalytic domain.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.06% Calcium chloride, 0.79% Tris HCl, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Matrix metallopeptidase 14 (membrane inserted)
    • Matrix metalloproteinase 14
    • Matrix metalloproteinase-14
    • Membrane type 1 matrix metalloproteinase
    • Membrane type 1 metalloprotease
    • Membrane type matrix metalloproteinase 1
    • Membrane-type matrix metalloproteinase 1
    • Membrane-type-1 matrix metalloproteinase
    • MMP 14
    • MMP X1
    • MMP-14
    • MMP-X1
    • Mmp14
    • MMP14_HUMAN
    • MMPX1
    • MT MMP 1
    • MT-MMP 1
    • MT1 MMP
    • MT1-MMP
    • MT1MMP
    • MTMMP 1
    • MTMMP1
    see all
  • Function
    Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7.
  • Tissue specificity
    Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors.
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization
    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

References

ab168877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up