Recombinant Human MMP22 protein (denatured) (ab180279)

Overview

  • Product name
    Recombinant Human MMP22 protein (denatured)
  • Protein length
    Protein fragment
  • Description
    Recombinant Human MMP22 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSYTLTPARLRWDHFNLTYRILSFPRNLL SPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVS ALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDL VHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYG
    • Molecular weight
      23 kDa including tags
    • Amino acids
      79 to 254
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_008914.

Specifications

Our Abpromise guarantee covers the use of ab180279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • Femalysin
    • Matrix metallopeptidase 21
    • matrix metallopeptidase 23B
    • matrix metalloproteinase 22
    • matrix metalloproteinase 22, formerly
    • Matrix metalloproteinase 23, soluble form
    • Matrix metalloproteinase 23B
    • matrix metalloproteinase in the female reproductive tract
    • Matrix metalloproteinase-21
    • Matrix metalloproteinase-22
    • Matrix metalloproteinase-23
    • MIFR
    • MIFR 1
    • MIFR-1
    • MMP 21
    • MMP 22
    • MMP 23
    • MMP-21
    • MMP-22
    • MMP-23
    • MMP21
    • MMP22
    • MMP22, formerly
    • MMP23
    • MMP23_HUMAN
    • MMP23A
    • MMP23B
    • soluble form
    see all
  • Function
    Protease. May regulate the surface expression of some potassum channels by retaining them in the endoplasmic reticulum.
  • Tissue specificity
    Predominantly expressed in ovary, testis and prostate.
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain
    The toxin-like domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4.
  • Post-translational
    modifications
    N-glycosylated.
    Proteolytic cleavage might yield an active form.
  • Cellular localization
    Endoplasmic reticulum membrane. Membrane. A secreted form produced by proteolytic cleavage may also exist.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180279 (3μg).

References

ab180279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up