Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSA AQGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSF PRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHT DCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGV WLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLH RLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATT PPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLA LGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG
    • Amino acids
      1 to 390
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Femalysin
    • Matrix metallopeptidase 21
    • Matrix metallopeptidase 23A
    • Matrix metallopeptidase 23A (pseudogene)
    • Matrix metallopeptidase 23B
    • Matrix metalloproteinase 22
    • Matrix metalloproteinase 23
    • Matrix metalloproteinase 23B
    • Matrix metalloproteinase in the female reproductive tract
    • Matrix metalloproteinase-21
    • Matrix metalloproteinase-22
    • Matrix metalloproteinase-23
    • MIFR
    • MIFR-1
    • MIFR1
    • MMP 23
    • MMP-21
    • MMP-22
    • MMP-23
    • MMP21
    • MMP22
    • MMP23_HUMAN
    • MMP23A
    • MMP23B
    • soluble form
    see all
  • Function
    Protease. May regulate the surface expression of some potassum channels by retaining them in the endoplasmic reticulum.
  • Tissue specificity
    Predominantly expressed in ovary, testis and prostate.
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain
    The toxin-like domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4.
  • Post-translational
    modifications
    N-glycosylated.
    Proteolytic cleavage might yield an active form.
  • Cellular localization
    Endoplasmic reticulum membrane. Membrane. A secreted form produced by proteolytic cleavage may also exist.
  • Information by UniProt

Images

  • ab160066 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up