Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15819
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELEEGQKGVGDGT VSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSV RFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKE NMKLPQPPEGQTYNN
    • Molecular weight19 kDa including tags
    • Amino acids1 to 145
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab116480 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesalthough stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.24% Tris, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 1 alpha 25 dihydroxyvitamin D3 inducible
    • DDVit 1
    • DDVIT1
    • EDAF-1
    • EDAF1
    • EDPF-1
    • EDPF1
    • Enterocyte differentiation associated factor EDAF 1
    • Enterocyte differentiation promoting factor
    • Enterocyte differentiation-associated factor 1
    • Enterocyte differentiation-promoting factor 1
    • Methyl methanesulfonate sensitive 2
    • MMS 2
    • MMS2
    • MMS2 homolog
    • UB2V2_HUMAN
    • UBE2V 2
    • UBE2V2
    • Ubiquitin conjugating enzyme E2 variant 2
    • Ubiquitin conjugating enzyme E2v2
    • Ubiquitin-conjugating enzyme E2 variant 2
    • UEV 2
    • UEV2
    • Vitamin D3 inducible protein
    • Vitamin D3-inducible protein
    see all
  • FunctionHas no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
  • Tissue specificityDetected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
  • Sequence similaritiesBelongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

References for Recombinant Human MMS2 protein (ab116480)

ab116480 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"