Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELEEGQKGVGDGT VSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSV RFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKE NMKLPQPPEGQTYNN
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 145
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab116480 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.24% Tris, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 1 alpha 25 dihydroxyvitamin D3 inducible
    • DDVit 1
    • DDVIT1
    • EDAF-1
    • EDAF1
    • EDPF-1
    • EDPF1
    • Enterocyte differentiation associated factor EDAF 1
    • Enterocyte differentiation promoting factor
    • Enterocyte differentiation-associated factor 1
    • Enterocyte differentiation-promoting factor 1
    • Methyl methanesulfonate sensitive 2
    • MMS 2
    • MMS2
    • MMS2 homolog
    • UB2V2_HUMAN
    • UBE2V 2
    • UBE2V2
    • Ubiquitin conjugating enzyme E2 variant 2
    • Ubiquitin conjugating enzyme E2v2
    • Ubiquitin-conjugating enzyme E2 variant 2
    • UEV 2
    • UEV2
    • Vitamin D3 inducible protein
    • Vitamin D3-inducible protein
    see all
  • Function
    Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
  • Tissue specificity
    Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

References

ab116480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up