Overview

  • Product nameRecombinant Human MN1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ10571
    • SpeciesHuman
    • SequenceSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEA HDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNR FGTFVAALT
    • Molecular weight38 kDa including tags
    • Amino acids1212 to 1320

Specifications

Our Abpromise guarantee covers the use of ab116773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA003644
    • AA009236
    • dJ353E16.2
    • Meningioma (disrupted in balanced translocation) 1
    • Meningioma (translocation balanced)
    • Meningioma 1
    • meningioma chromosome region 1
    • MGCR
    • MGCR1
    • MGCR1-PEN
    • MN1
    • MN1_HUMAN
    • Probable tumor suppressor protein MN1
    • RGD1565571
    see all
  • FunctionMay play a role in tumor suppression.
  • Tissue specificityUbiquitously expressed. Highest levels in skeletal muscle.
  • Involvement in diseaseNote=A chromosomal aberration involving MN1 may be a cause of acute myeloid leukemia (AML). Translocation t(12;22)(p13;q11) with TEL.
    Note=Defects in MN1 involved in the development of meningiomas, slowly growing benign tumors derived from the arachnoidal cap cells of the leptomeninges, the soft coverings of the brain and spinal cord. Meningiomas are believed to be the most common primary tumors of the central nervous system in man.
  • Information by UniProt

Recombinant Human MN1 protein images

  • 12.5% SDS-PAGE showing ab116773 at approximately 37.62kDa stained with Coomassie Blue.

References for Recombinant Human MN1 protein (ab116773)

ab116773 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"