Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECG TPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLE EVEEIVFNLT
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MNAT 1
    • CAP35
    • CDK activating kinase assembly factor MAT1
    • CDK-activating kinase assembly factor MAT1
    • CDK7/cyclin H assembly factor
    • CDK7/cyclin-H assembly factor
    • Cyclin G1 interacting protein
    • Cyclin-G1-interacting protein
    • MAT1
    • MAT1_HUMAN
    • Menage a trois
    • Menage a trois 1 (CAK assembly factor)
    • Menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
    • MNAT CDK activating kinase assembly factor 1
    • Mnat1
    • p35
    • p36
    • RING finger protein 66
    • RING finger protein MAT1
    • RNF66
    • TFB3
    see all
  • Function
    Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II.
  • Tissue specificity
    Highest levels in colon and testis. Moderate levels are present thymus, prostate, ovary, and small intestine. The lowest levels are found in spleen and leukocytes.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up