Recombinant Human MOBK1B protein (ab102026)

Overview

  • Product name
    Recombinant Human MOBK1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLK HAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCT EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET LFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 216
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab102026 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • B1, Mps One Binder kinase activator like 1B (yeast)
    • C2orf6
    • Chromosome 2 open reading frame 6
    • FLJ10788
    • FLJ11595
    • MATS1
    • MOB kinase activator 1A
    • MOB1
    • Mob1 alpha
    • Mob1 homolog 1B
    • MOB1 Mps One Binder homolog A
    • MOB1 Mps One Binder kinase activator like 1B
    • Mob1A
    • MOB4B
    • Mob4B protein
    • MOBK1B
    • Mobkl1b
    • MOL1B_HUMAN
    • Mps one binder kinase activator like 1B
    • Mps one binder kinase activator-like 1B
    • Protein Mob4B
    see all
  • Function
    Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L.
  • Tissue specificity
    Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
  • Sequence similarities
    Belongs to the MOB1/phocein family.
  • Information by UniProt

Recombinant Human MOBK1B protein images

  • 15% SDS-PAGE analysis of ab102026 (3µg)

References for Recombinant Human MOBK1B protein (ab102026)

ab102026 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up