Recombinant Human MOBK1B protein (ab102026)

Overview

  • Product name
    Recombinant Human MOBK1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLK HAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCT EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET LFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 216
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab102026 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • B1, Mps One Binder kinase activator like 1B (yeast)
    • C2orf6
    • Chromosome 2 open reading frame 6
    • FLJ10788
    • FLJ11595
    • MATS1
    • MOB kinase activator 1A
    • MOB1
    • Mob1 alpha
    • Mob1 homolog 1B
    • MOB1 Mps One Binder homolog A
    • MOB1 Mps One Binder kinase activator like 1B
    • Mob1A
    • MOB4B
    • Mob4B protein
    • MOBK1B
    • Mobkl1b
    • MOL1B_HUMAN
    • Mps one binder kinase activator like 1B
    • Mps one binder kinase activator-like 1B
    • Protein Mob4B
    see all
  • Function
    Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L.
  • Tissue specificity
    Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
  • Sequence similarities
    Belongs to the MOB1/phocein family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102026 (3µg)

References

ab102026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up