Overview

  • Product name
    Recombinant Human MOCS3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLP PKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQY LAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNS AVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPL VSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTG VLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAAC GERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAF HLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGT QEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWA AKIDGTFPQY
    • Amino acids
      1 to 460
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenylyltransferase MOCS3
    • dJ914P20.3
    • MGC9252
    • MOCS 3
    • MOCS3
    • MOCS3_HUMAN
    • Molybdenum cofactor synthesis 3
    • Molybdenum cofactor synthesis protein 3
    • Molybdopterin synthase sulfurylase
    • Molybdopterin-synthase sulfurtransferase
    • MPT synthase sulfurylase
    • Sulfur carrier protein MOCS2A adenylyltransferase
    • Sulfur carrier protein MOCS2A sulfurtransferase
    • Sulfurtransferase MOCS3
    • UBA 4
    • UBA4
    • UBA4 ubiquitin activating enzyme E1 homolog
    see all
  • Function
    Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.
  • Pathway
    tRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis.
    Cofactor biosynthesis; molybdopterin biosynthesis.
  • Sequence similarities
    In the N-terminal section; belongs to the hesA/moeB/thiF family. UBA4 subfamily.
    Contains 1 rhodanese domain.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • ab162141 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up