Recombinant Human MOGAT2 protein (ab164209)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLT VLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPS RNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPF FRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFT LLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSIL VEIFSPFTIKIIFWCLMPKYLEKFPQRRLSDLRN
    • Amino acids
      1 to 284
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 acylglycerol O acyltransferase 2
    • 2-acylglycerol O-acyltransferase 2
    • Acyl CoA:monoacylglycerol acyltransferase 2
    • Acyl-CoA:monoacylglycerol acyltransferase 2
    • DC5
    • DGAT2L5
    • Diacylglycerol acyltransferase 2 like protein 5
    • Diacylglycerol acyltransferase 2-like protein 5
    • Diacylglycerol O acyltransferase candidate 5
    • Diacylglycerol O-acyltransferase candidate 5
    • EC 2.3.1.22
    • FLJ22644
    • hDC5
    • hMGAT2
    • Mgat1l
    • MGAT2
    • MGC119183
    • MGC119184
    • MGC119185
    • MGC189143
    • mogat2
    • MOGT2_HUMAN
    • Monoacylglycerol O acyltransferase 1 like
    • Monoacylglycerol O acyltransferase 2
    • Monoacylglycerol O-acyltransferase 2
    see all
  • Function
    Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Has a preference toward monoacylglycerols containing unsaturated fatty acids in an order of C18:3 > C18:2 > C18:1 > C18:0. Plays a central role in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. May play a role in diet-induced obesity.
  • Tissue specificity
    Highly expressed in liver, small intestine, colon, stomach and kidney.
  • Pathway
    Glycerolipid metabolism; triacylglycerol biosynthesis.
  • Sequence similarities
    Belongs to the diacylglycerol acyltransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab164209 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up